SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000482 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000482
Domain Number - Region: 322-397
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000338
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.016
Further Details:      
 
Domain Number - Region: 189-289
Classification Level Classification E-value
Superfamily Bet v1-like 0.00118
Family STAR domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000482
Sequence length 452
Comment protein Name="PYU1_T000482" Note="Protein of unknown function" AED:0.143487858719647 QI:0|-1|0|1|-1|1|1|0|452
Sequence
MNSKTKFTSPFPPLQLSENDGERLDQLAHLFMCKNIAQYEAFLEQRDGQQHHIDDHAWKL
VKQRERIRVYSERTKNLNYGEDTTSRYTDSDSSSSATKTAPPLNRSNSNAVSSAATPDLP
VMLVVGAVEGTLDDMMYGVVNHTLEDMRVKSAYVRDNVGDGAVLATLATPTHENPFQSFT
IKWMENEQMHVLRPMVRNRDFVYMESTGITNLSSGERIGFHLLHSVHFPQTHELASRVRG
NLSICGIYRQIPGTNDVDVHITGILNPGGNLMRAVVVKAAADALVSVWKNVECAHMKKLT
WLLRTMRRSFSNASDTSSGKSGSEVGCCTTCKKAPSSFAVSVLGDLRKRKCNLCWKYVCS
SCRIKKTLSHVNAPSGRLRQREFPFCGACIKEATTSNAFMVAQREFASVDLLSDLFATNQ
SEQILSMDGGSHSSSNPLAESMITNETGAFSS
Download sequence
Identical sequences K3W691
PYU1_T000482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]