SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000516 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000516
Domain Number - Region: 291-357
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000921
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.048
Further Details:      
 
Domain Number - Region: 165-251
Classification Level Classification E-value
Superfamily Bet v1-like 0.00161
Family STAR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000516
Sequence length 406
Comment protein Name="PYU1_T000516" Note="Protein of unknown function" AED:0.293186043186043 QI:0|-1|0|1|-1|1|1|0|406
Sequence
MTKFPLSASTFPTLELPQKDIDEIEALSSLLVERTLIQYHEHEVVRRGVVDTTRWKKVTQ
REDIKVFKERASAAASSSTWSPDAATNSYGSVIPMLMSVGTISGDLFDVMYGVLSPTTEV
MRIKSLHDEDGLLDCRVLATLINPSAEDPLRSLTLRWAAKGSPLIMTPVVRNRDVVYMES
TGIAYTKSGERIGYQLLHSVEVPGVPEFVEHQLVRAELSYCYIYRQKTAEIVDVFMRGVL
DPRGGVPSYIGAISTAEALVAVSASAQCAEMKKLTWLLRTSKADPPSTLPDTSHCAVCLQ
ATRLFNFKSMMKYSCAVCLEQICSKCCVTRKISYISPLNFNEVLQTKFPFCVRCVERALA
KSAIEIATEEASDPSLFNMSFGAMADIMSAPTSFSSTSSMAARTAS
Download sequence
Identical sequences K3W6C5
PYU1_T000516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]