SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000532 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000532
Domain Number 1 Region: 37-303
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.25e-54
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 357-660
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.87e-32
Family Extended AAA-ATPase domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000532
Sequence length 742
Comment protein Name="PYU1_T000532" Note="Similar to mcm5-B: DNA replication licensing factor mcm5-B (Xenopus laevis)" AED:0.013497720840326 QI:0|0.5|0|1|1|1|3|0|742
Sequence
MDWDVGRVSSMGMESASAVAARDAQDTSPIAIQKRLHEFLRNFRVGPIFFYREQLIANYR
RNNYFFTMNLSHLATYDQFLQDLILKNPKEYLPLLENAAKEMLAYLLVLNRSEQTTTMDG
AIGNESMNVKNLPDIQAVITSDQAPTALRAVHAQEINRLVKVPGIVISATRVRTKCVSAT
LRCKNCGNSKRVAVSGMGGINIPRICDRNREEEPSSELCPKDSYIVLPDRCDYVDQQTLK
LQENPEVVPTGEMPRNLALIADRHLVDRASPGTRVSVVGITSVVNAGAKQIGAVAIRTLY
LRVVGIEIDEEGAGRAKATFSPAEEEKFHEMARDPDLYDKLSSSIAPSIYGDYTTNIKKA
IACLLVGGSRKRLPDGMILRGDINVLLLGDPSTAKSQFLKFVEKVAPVGVYTSGKGSSAA
GLTASVIKDSKGEFYLEGGAMVLADGGVVCIDEFDKMRESDRVAIHEAMEQQTISIAKAG
ITTILNSRASVLAAANPVFGRYDDMRSASENIDLMSTILSRFDMIFIVRDIQDDTRDRQM
AAHVVRIHTNSLGTVNGAKSAVEEKTGEYEPWLMKKFITYCRTRCAPRLSVHAAQALQDF
YVGVRDDVRKNQGGETTIPVTVRQLEALVRISESLAKMKLQNEATIDHVREAVRLFSVST
MNAAKDGGTQGLFGGFHEKAQEVEHSINRTLRIGMRVETAALYSRLEAQGYNPNAIQRAI
RAMVQKGSLRQLNQYKFVSRVK
Download sequence
Identical sequences K3W6E1
PYU1_T000532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]