SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000547 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000547
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.44e-31
Family Ribosomal protein S16 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000547
Sequence length 106
Comment protein Name="PYU1_T000547" Note="Similar to rpsP: 30S ribosomal protein S16 (Acidiphilium cryptum (strain JF-5))" AED:0.0173913043478261 QI:12|1|0.5|1|1|1|2|0|106
Sequence
MVVRLRLARWGRKDLPFYRIVAADARAPRDGKHLEILGTFNPIAAADGVKELRVNNERVR
YWISVGAQPSDRVSHLLGIANILPMPPTRQYGIKSIPKKDRAPAKK
Download sequence
Identical sequences K3W6F6
PYU1_T000547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]