SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000550 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000550
Domain Number 1 Region: 88-204
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-25
Family FHA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000550
Sequence length 413
Comment protein Name="PYU1_T000550" Note="Similar to Ppp1r8: Nuclear inhibitor of protein phosphatase 1 (Mus musculus)" AED:0.241243961352657 QI:0|0.66|0.5|0.75|1|1|4|0|413
Sequence
MPLREPAPPLTLSFGMTNTNETMTAAAPSAEDAASNASTILDQCLQLPKLNLGSCSMRSG
TGVSTAGVRRKYLELIEPLKYPFTTGAPAWCVQDFPEKKPRAISLLDVYKNHEFLTTHTV
YQKGMYLIGRNAAICDIVLSHCSISRLHAGIMHHEDGTSVYLVDLGSAHGTFLDGVRLKP
CQPTLMLHGSQLKFGASSRSYTYKSFDSREQIAAIVNAQIGLNADELELNRNTLLNRAVS
YRLELSPSMQNGDDDPMAYPQQYNGGFVASYPEDPQGHQRRSSTDDLTLSLAAFRHDEQP
ARKRSRGQSGTSQGSSDNSMGGDASHFALDNIDVQDVEEEEEEMMLAPAAVPKRVHFTPH
PPTEIPPMTYAWSMAAADAERDASPQPIDSGSAVATVGGGAFGLAIQITSDAH
Download sequence
Identical sequences K3W6F9
PYU1_T000550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]