SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000573 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000573
Domain Number 1 Region: 142-227,383-508,984-1197
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.15e-38
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 
Domain Number 2 Region: 509-525,718-737,772-831,890-990
Classification Level Classification E-value
Superfamily HAD-like 6.76e-35
Family Predicted hydrolases Cof 0.035
Further Details:      
 
Domain Number 3 Region: 520-552,594-797
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.27e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0087
Further Details:      
 
Domain Number 4 Region: 223-299,341-382
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-17
Family Calcium ATPase, transduction domain A 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000573
Sequence length 1384
Comment protein Name="PYU1_T000573" Note="Similar to ALA3: Phospholipid-transporting ATPase 3 (Arabidopsis thaliana)" AED:0.0978339350180506 QI:0|-1|0|1|-1|1|1|0|1384
Sequence
MASKGRLFGGGGPRVEDEELLRHQTRSTSAGSNPPLLTKESNSSSDYVYAEMGSPALLQQ
PQRIGDADDSGRHKRTLTGGGGGGKLPATKNRGNSRTGPAAVGHDYSNNNNGGGDSDKAK
QELREVYFNYAPGNAVFDKSTNVVITSKYNVLTFLPKFLKESFTKVANFFFLVVCVLQSI
DSISNTYGVPTNAPVLLFVISIDAVFAIMEDMRRHTSDREANSAKCHIVRNGHIEDHLWS
EVKVGDFLQIRNREVIPADVLILSVSEPVGEAASGICYVETKSLDGETNLKLRQAIQPTM
NALVNPQELVLLRGIVKFETPNPYINKFAGKVEVTVSEGCGMEVMPLSVKNVLLRGCNLR
NTDWVFGLVLNTGPDTKIMQSASAAPSKWSDVMLSMNKMIAILCLGLFVACAVAATCYVT
WQYDIVRNTWYIKLSDDVRAQPRWESFIQMMFYYFLLLYQVIPISLYVSMTSVKFLQAKF
MVWDLEMYHAETDTPAIVRTMALNEELGQISYVFSDKTGTLTCNIMEFRKCSINGISYGS
GMTEIGRAALVRANKPIPPEPKMDAGMKKMQYVNFVDPSFFKAMNGGTGAAQRDNIHQFF
EHLAVCHTVIPEKLETGEVRLSASSPDEQALVAGASFVGFNFVNRGVGKATIEIFGERQV
FDILDVLEFNSTRKRMSVVVRRPNGELYLYSKGADMMIYQRLKDDPAMDQLKKVTRDHME
KYADDGLRTLALAVKKLDEKWFQKWKIKFDEAQGNVAELDRRKDGKPNAIDSLMEEIEEN
LELIGATAIEDKLQDGVPKCLAHLTAAGIKVWMLTGDKEETAINIAYACSLLDNSIQQVI
VNCTTCPNEEAIIARLNAAGREYREKTKADSKLEISLIIDGEALEWALSPRTAPHLLEFT
KLCRAVICNRVSPAQKAEMVRLVRDNIPVARTLAIGDGANDVAMIQAAHVGVGISGQEGM
QAVNSSDYAIAQFRFLERLLLVHGRWNYIRISKLVLYMFYKNITLVLAQYWYGYLSGASG
SKMYWELGVQVYNVAFTGIPIIMVGVMDKDLPARFSIEYPDLYRKGPERYYFNMYTFLRW
VGAAVFESLVIFVVMSYGFNASESAPGSESRVEYGMVAFSMTVLIVNIKIWLISDTWTFL
SLICWSLSVLSWFGFAAMGTEVTFFSRFKVAYDEFGSFAPTAWSWGYVLVVLMGCVIALG
RHFTYNQYQRAFYPELNQVLQESVEKRKRRLTINHIEEQTLSMSLDDVHATAFMSDFRGT
DLTVKSYRTNSGGVNMHDAIAEDEIYESSGGGVPSLAMSDNVSLTADSFSASVYSSSVSS
EVGSGWDRIPTKLFKSNASRRNTGYAFSCDEETTLAESYIASNSLPRSDAVPAALRNSIS
RHMS
Download sequence
Identical sequences K3W6I2
PYU1_T000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]