SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000591 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000591
Domain Number 1 Region: 48-557
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.27e-157
Family Aconitase iron-sulfur domain 0.00000000000247
Further Details:      
 
Domain Number 2 Region: 563-783
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 9.81e-62
Family LeuD-like 0.0000000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000591
Sequence length 789
Comment protein Name="PYU1_T000591" Note="Similar to Aconitate hydratase, mitochondrial (Gracilaria verrucosa)" AED:0.0513063233623627 QI:0|0|0|1|1|1|2|0|789
Sequence
MYALSSSTRAAARQHLRTTAAKASMSSSCGVPVPLSVLDPKGSPTIDQTYEKMEKNLHHV
RKTWGNKPLTLAEKIIYGHLDNADQVAVRGETYLKLRPDRVAMQDATAQMAVLQFISSGL
PKTAVPTTIHCDHLITAEKGSTTDLNNANIVNKEVYDFLSSAGAKFGMGFWKPGSGIIHQ
IVLENYAFPGGLMIGTDSHTPNAGGLGMCAIGVGGADAVDVMAGMAWELKAPKVIGVKLT
GKLSGWTSPKDVILKVADILTVKGGTGAIVEYFGPGVESISCTGMGTICNMGAEIGATCS
TFPYTDRMADYLKATTRSGIASAADSFKANLRADEGAQYDQIIEINLDELKPLVNGPFTP
DLANEAGEQLKAASEKNGWPTELSAGLIGSCTNSSYEDMTRCAELINQAEKAGLKFKVPY
YVTPGSEQVRATIERDGVLDTFLKAGGTALANACGPCIGQWNREDLNMGVKNSIFTSYNR
NFAKRNDGNPATHAFVTSPEMVTVCSIAGTTTFNPATDSITTPSGEQFKFEAPFGKELPP
RGFDAGEETFQAPPADGSSLKVNVDAASDRLALLSPFDEWHGKDFESLPVLIKAKGKCTT
DHISMAGPWLKYRGHLDNISNNLLIGAENAETGETNSVKNQFTGVFDKVPAVARQYKAQG
VSWVVVGDENYGEGSSREHAALEPRHLGGRAVIVKSFARIHETNLKKQGMLPLTFANPAD
YDKISGNDKISILGLNEFQPGKQLTLRVEPASGAAFEIQVNHTFNDEQIEWFKNGSALNL
MKKVNAAKQ
Download sequence
Identical sequences K3W6K0
PYU1_T000591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]