SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000603 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000603
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.13e-24
Family Canonical RBD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000603
Sequence length 107
Comment protein Name="PYU1_T000603" Note="Similar to RBM24: RNA-binding protein 24 (Homo sapiens)" AED:0.465365884916058 QI:0|0|0|0.5|0|0|2|0|107
Sequence
MQPAHQQQQQHTPTGSNDESDRKLFVRGLSWDTSNDALRAEFQKYGELEEAMIARDRRTG
KSKGFGFVTYKYRAGAERALQQPQKQIDVRSNDIVQPGVSGKRKRRQ
Download sequence
Identical sequences K3W6L2
PYU1_T000603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]