SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000626 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000626
Domain Number 1 Region: 263-307
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000137
Family Leucine zipper domain 0.0027
Further Details:      
 
Weak hits

Sequence:  PYU1_T000626
Domain Number - Region: 334-470
Classification Level Classification E-value
Superfamily NTF2-like 0.000456
Family Rpa4348-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000626
Sequence length 499
Comment protein Name="PYU1_T000626" Note="Similar to PAN1: Actin cytoskeleton-regulatory complex protein PAN1 (Kluyveromyces lactis)" AED:0.162133030990174 QI:0|-1|0|1|-1|1|1|0|499
Sequence
MSSATGLHSAREELGLPNVAPHMGSSSAFMNLGGQHDGSQHSLPKPMSLSPRTFGMDDLR
DFCGPLGTFKTGLTPRVFSTGLTPRSGFTPRFTTGFTPRISVTGLGLQQQQQQQQQQQQQ
NDTNAFFSRNTGFSPRASEAPQSQKISPTGFTPKDVSAMKMPMRYPGAFNTGSNSPQKMT
MGDYKQPITQLQHSQHQQVHHQYGGHHAGGHHEPMNQNDMAMNMNMFDYMGRPTIHQPQH
MHDPRTSKTSPISDKGSDQDDLDERRRMKNRERVRKCRKRKQDRLNFLEDRTAELEKENH
VLKTKMARKSVGAAAEPLNEAQLKELRKKQNTTIASYIRAYNEVETGVFDVTARNIWSEN
AEILYGNNGSRVAGLEMIMGNKRASAAVFSMYKIKQYTVQWKQNSNDKCAVHWEVDVALR
PNAPQNIPMTAPFAELGAYFDENEMLSFRMTSHLTFDEGRIVEEIRQLNLSPISELVLGK
FAQDPKKVSDVLRCLLVAA
Download sequence
Identical sequences K3W6N5
PYU1_T000626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]