SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000642 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000642
Domain Number 1 Region: 31-120,273-395,883-1101
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-41
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 
Domain Number 2 Region: 396-412,608-721,805-889
Classification Level Classification E-value
Superfamily HAD-like 2.56e-33
Family Predicted hydrolases Cof 0.077
Further Details:      
 
Domain Number 3 Region: 407-441,481-686
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.01e-19
Family Metal cation-transporting ATPase, ATP-binding domain N 0.014
Further Details:      
 
Domain Number 4 Region: 128-194,231-269
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000017
Family Calcium ATPase, transduction domain A 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000642
Sequence length 1205
Comment protein Name="PYU1_T000642" Note="Similar to Atp8a1: Probable phospholipid-transporting ATPase IA (Mus musculus)" AED:0.0116086235489221 QI:0|-1|0|1|-1|1|1|0|1205
Sequence
MSGSKASNNQQVKSEHRIVHASDAARNTELGYCDNFIITSKYTVISFIPKFLFESFRKLA
NLYFLAICIMQCIPQISNTSGQPSTLPPLAFIIFVDAVFAILEDRQRHIADQIANSRPTY
VLDASTKQFGSKSWANVVVGDVIRLNNRDLVPADILVLAVSELPDAPPSGICYVETKSLD
GETNMKVRSAMECTLAEMGSIDNILRAKGVVRCEQPNNVINSFQGVLELEGKEKQSIPYE
SIILRGCIIRNTDWVHGIVLNTGKDTKIMMSNSAPPSKMSTMDQSINNYIVALLVILILF
SAIGATGAVIWKSTNKKPWYLALDDSGNSAGVDWIIMLFYYMLLMYQFVPISLCVSMSMV
KYLQAQFIQWDKQIYHDTTDTPTLVRSMSLNEELGQISYVFSDKTGTLTCNIMEFRKCSI
GGVSYGKGTTEIGLAAMKRSGKPIPEPSTSQQSAKPVPYVNFDGPELFADMKGTSGSNQQ
RRINAFFTHLAICHTVIPERRENSTEVILSASSPDEQALVAGAGFFGFEFMNRSPGIAHA
KIQGVNQQFELLDVLEFNSTRKRMTIIVRHPDGKVCLYTKGADAIIFARMAKTKDNEASQ
LQEVTRRHIDAYAEEGLRTLTIAIRELDPAYYEAWARRFHEAQNNLEEIDKRKKDLPNAI
DECMDEVESELELLGATAIEDKLQSGVPDTIANLASAGVKIWVLTGDKEETAINIGFACQ
LLTNDMTVLVISAKHFPTPELIEAELLSQITARAAEVHTYFSSPVTSRGELKSVALVIDG
ETLIHALTGACRPLLAEFSQYCKAVIACRVSPAQKAQMVALIKEYVPGVRTLAIGDGAND
VSMIQEAHIGVGISGQEGMQAVNSSDYAIAQFRFLERLLLVHGRWNYRRMSQLVVYMFYK
NILFTAAQYWYTLLCGFSGQKFFLETGVQLYNICMTSIPIIALSIYDQDVNDELAMKFPK
LYYVGPRDEDLNKSTFSLWVIGAILESVILTLFVLNGMENGGFHGGTSSMWLDGNIIFTL
VVLIANVKLMLYQNSFHVFNHVLYWGSFFIWLLVAFVAGEVSMLSDLTWELMLQQMFKTN
AFWALLLFIPVATLSYTYLINGMKLTFMPEYWQLAKEVIKFNLSKDLLQWDDNTNASVPV
PAKLKQDKHAGRVGLVVPTNGKQAHKKTPLERVYHGFAFSMDSHAGAAEANISMKGTSFR
SVREE
Download sequence
Identical sequences K3W6Q1
PYU1_T000642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]