SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000663 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000663
Domain Number 1 Region: 288-385
Classification Level Classification E-value
Superfamily DUSP-like 0.000000106
Family DUSP, domain in ubiquitin-specific proteases 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000663
Sequence length 426
Comment protein Name="PYU1_T000663" Note="Similar to USP48: Ubiquitin carboxyl-terminal hydrolase 48 (Homo sapiens)" AED:0.000364166059723225 QI:0|1|0.5|1|1|1|2|91|426
Sequence
MERLSLGVLAHLFELLTAWDVAQLTATCTVLHPREPIVQDAVALVVKHRFGDVLASLRED
DPLWPRSVIILRVAEVLTLKKWLGSASVQSYEDAAASCASKSSVIVSKAWFLAWKKRSQG
YEQFLMQFRHTKKKQQQRVRQQQSRSKKEKKLGTWTNDAAAVVHKVVDTEAAATREAGDL
VVCQHGDLLPVSSCVGRSKRVVISKSMFTKMSLYAPDLHGFPLYSSDCEKCTQEKEAKER
EVEQRRQERFESQIAGSNDLLDLLLRKSGYPNELFSPASSRGNTHLSLHHSVGKTYFLVP
KKWLIKWRNFVRSLDNAGYPGPILNAELVCLAHQRNVVPPYITMFLSGFSIEQSLQATQA
LGTCASKQYEIVTLGEWEALYDRYCAEYAVGFDVFDGSYHWQTQECNICYYGMGGSGTEK
RRNASR
Download sequence
Identical sequences K3W6S2
PYU1_T000663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]