SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000672 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000672
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000205
Family eIF5a N-terminal domain-like 0.008
Further Details:      
 
Domain Number 2 Region: 60-118
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000428
Family Cold shock DNA-binding domain-like 0.004
Further Details:      
 
Domain Number 3 Region: 123-175
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000105
Family Cold shock DNA-binding domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000672
Sequence length 176
Comment protein Name="PYU1_T000672" Note="Similar to efp: Elongation factor P (Gluconobacter oxydans)" AED:0.0420918744638684 QI:0|1|0.5|1|1|1|4|0|176
Sequence
MALDIDGKIYRVTKHQHVKPGKGGAYTQVEMKEIKTGNKINRRFRAAESVQKAPLGPDQF
FQFLYHEGNKLVLMHNSTFEQMEVPRDLFSERQLDFLLEGMTLTLQIVEGDVLWANMPEN
VTLAVTKTTAKGVADTALSVKDATLENGAVVKVPLFIEVGNQVRIATEDGSYVDKL
Download sequence
Identical sequences K3W6T1
PYU1_T000672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]