SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000693 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000693
Domain Number 1 Region: 206-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000095
Family SPRY domain 0.047
Further Details:      
 
Domain Number 2 Region: 13-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000916
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000693
Sequence length 298
Comment protein Name="PYU1_T000693" Note="Similar to RanBPM: Ran-binding proteins 9/10 homolog (Drosophila melanogaster)" AED:0.206214166361259 QI:0|0.5|0.4|1|1|1|5|509|298
Sequence
MKSKSKSKTLHHTLNDLPDTVLAHILAYASARDVEAATVASKVVALQVVPQYPIWKTIFC
RRWEKINFPLDGALCEEFPVLVEIDSRLRKQFPSSWSESRMYQLLAHAITPVPSYVDIEA
TRKSDPYTWTGHIVVPLSADITHADYHPDARRFKDFAYSGLVLGGDRSVRANAAFPTTLH
VQVFKRRIPKTRNQFTYQIGVARSGYFEITISRRREQKGPLVRLSGRDMASIGVGTERFR
LVDRQPGWDEFSFGYHGDDGRFYHDTGNGRHFGPTFDIGDTVGCGTSSLTSAKRRRIW
Download sequence
Identical sequences K3W6V2
PYU1_T000693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]