SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000694 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000694
Domain Number - Region: 3-59
Classification Level Classification E-value
Superfamily F-box domain 0.000458
Family F-box domain 0.013
Further Details:      
 
Domain Number - Region: 221-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000696
Family Galectin (animal S-lectin) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000694
Sequence length 264
Comment protein Name="PYU1_T000694" Note="Similar to ranbp10: Ran-binding protein 10 (Danio rerio)" AED:0.491057408142561 QI:0|0|0|0.66|1|1|3|0|264
Sequence
MALTSLPDDVLARMLAFAAPRDVEAVAVASKAVARHVLPRFPIWKRIFCARWAILNFPLD
GADDERDAIDVEIDPRLRAQLPSSCSESRMFQLLAHAITPVPSYADIRATMLSRRGPGFG
MMEHTIAHLNRDLSVCTLNSRRGCGARAVDIAFTGQFPGGNRSVRANTSIPPTFRVQVYK
QRIPHSDSRFKYQIGVTASGYFEISIAPRKQEQQQRQPRISGSDLTSIGVGTDHFCLVGK
QPGWDRHSFGYHGDDGQYYHKTGY
Download sequence
Identical sequences K3W6V3
PYU1_T000694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]