SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000733 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000733
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-30
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000733
Sequence length 133
Comment protein Name="PYU1_T000733" Note="Similar to PPIE: Peptidyl-prolyl cis-trans isomerase E (Bos taurus)" AED:0.349791738979521 QI:0|0|0|0.25|1|1|4|0|133
Sequence
MAAVMDKKSKRTLYVGGLEKQVTEQVLHAAFVPFGPIKSVQVPMDYATQSSKGFGFVEYE
DTADAQEAMDNMDESELFGRTLRVSIAKPDKPKLGARKPVWAETDEAKDTITPDEPEHAQ
QQPTVSSRVSNQA
Download sequence
Identical sequences K3W6Z2
PYU1_T000733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]