SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000776 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000776
Domain Number - Region: 84-137
Classification Level Classification E-value
Superfamily ATP synthase D chain-like 0.0445
Family ATP synthase D chain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000776
Sequence length 221
Comment protein Name="PYU1_T000776" Note="Similar to prkrip1: PRKR-interacting protein 1 homolog (Danio rerio)" AED:0.106428462360666 QI:0|1|0|1|1|1|2|0|221
Sequence
MGRYTTVQTFTDQDAKAAISYSSATATAAASSSVSHYGPNGGDGATQGAGDASSSGGDKH
QSAKVSINRVENVSGSSAGAGSGDFHMYRAARRRELDRVERMEKEYEQRKIKEEFERKRL
QNMTEFEARAHKRAEKRRRRKERTKAKSLSTGDDDNGDSGDESKENADAPKQKKQKVTAA
DTQPEVLPETPGGVPEIPNDGSFLERMLTEQKEKQEQQQQQ
Download sequence
Identical sequences K3W735
PYU1_T000776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]