SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000798 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000798
Domain Number - Region: 178-213
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0502
Family Homeodomain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000798
Sequence length 485
Comment protein Name="PYU1_T000798" Note="Similar to DDB_G0271670: Uncharacterized protein DDB_G0271670 (Dictyostelium discoideum)" AED:0.297325102880658 QI:2|-1|0|1|-1|1|1|1|485
Sequence
QRLDQAPPARQQQLEPKVEPRVVDWKPDGKVVRALLRGMLRFGDLTDVGMFKLDHPNSFA
DEFKLQNFVVRSHLPSSTKVSEEQLLKTAAEISERAQRAIEDKQDNMKYADVEIKPSQVI
ERLYDNLKLRVAVQRALRDAKYAKRDDKGAYVLVAKQSDLPVLGISRDFPPWSWAEKEHD
WNSRKDTALLLGIYVHGFGAWEDILNDDLLHFHQQRALKGERMKKRAENLLKRLPPPDES
GDPKIVHNASVLVAGSQNSGPSLGAQFSAIINSNNPNKGRLERAAQRFAARQSSGASSIP
ESRVVAEDSIRRSHTQANSSSSVSSSSNAPDRQRKTSIPSSSPRNDEPEDGEVGGSSSAA
ASSTAAGRSSTSSKSSSSSKRAASIETEQIGGGSPRKKSKHHSSERSRKHRDRDASSTPS
KTKKARILTEEQCVEKWKPSKKLKDIRQVLKKMKIMADWSKNQTDEVVVEKVCKYVITIG
EAIDD
Download sequence
Identical sequences K3W757
PYU1_T000798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]