SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000809 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000809
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-41
Family GABARAP-like 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000809
Sequence length 108
Comment protein Name="ATG8" Note="Autophagy-related protein 8" AED:0.0364359101902197 QI:0|0.75|0.6|0.8|1|1|5|365|108
Sequence
MHKRQVEAQRIRSKYPDRIPVICEKADRSDIPDIDKKKYLVPADLTVGQFVYVIRKRIKL
SPEKAIFIFINNVLPPTAALMSNIYEEQKDVDGFLYITYSGENTFGQE
Download sequence
Identical sequences K3W768
PYU1_T000809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]