SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000823 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000823
Domain Number 1 Region: 110-306
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.24e-68
Family Tubulin, GTPase domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 302-416
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 7.33e-40
Family Tubulin, C-terminal domain 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000823
Sequence length 421
Comment protein Name="PYU1_T000823" Note="Similar to ftsZ1: Cell division protein ftsZ homolog 1 (Rhizobium meliloti)" AED:0.100583953960731 QI:0|1|0.81|1|1|1|11|0|421
Sequence
MVLLPVRRAAARLFTAEAKRCAFAGATTQRLAFSTEATDAAAAALRMGFKKSRKGEDVVE
SVSAAAADKAAAAEASTEPQQVERPAVVSSTQPLWLSQTHDAQDLSAFAPKIVVVGVGGA
GGNAVNNMIARGLQGVEFLVCNTDAQHLRTTLTENRVQMGPELTGGLGCGANPEVGREAA
ESAIEEIMERVKGANMMFVTAGMGGGTGTGAAPVIAQAAVEAGILTVAVVTKPFRFEGNN
RSKLAEYGLSELKQSVDTMIVIPNQNLFNMSTERTSLMDAFRLADDVLLDGVKNISDLMV
MPGLINLDFADVQSVMSNMGNAMMGSGEAEGDNRALRAAEMALANPLLGDISIKDAKGLL
VNITGGSDLTLFEVDEAGERVTKELEDPHANIIFGSSFDESLNGKVRVSIVATGIADLDK
K
Download sequence
Identical sequences K3W782
PYU1_T000823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]