SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000825 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000825
Domain Number 1 Region: 634-705
Classification Level Classification E-value
Superfamily CHY zinc finger-like 0.000000000000654
Family CHY zinc finger 0.0032
Further Details:      
 
Domain Number 2 Region: 359-410
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000376
Family Myb/SANT domain 0.011
Further Details:      
 
Domain Number 3 Region: 285-313
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000628
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number 4 Region: 194-219
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000157
Family CCCH zinc finger 0.0053
Further Details:      
 
Weak hits

Sequence:  PYU1_T000825
Domain Number - Region: 59-131
Classification Level Classification E-value
Superfamily UBC-like 0.00013
Family RWD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000825
Sequence length 773
Comment protein Name="PYU1_T000825" Note="Similar to SPBC18H10.09: Uncharacterized protein C18H10.09 (Schizosaccharomyces pombe)" AED:0.0242756359364612 QI:0|-1|0|1|-1|1|1|0|773
Sequence
MMSDTTSQQQTATAGLQDALQKEWAAVQRRYHAQRIAAQDEDKATRLRCFVSLSDPDLPE
QFKGETELLIELPAKYPDEEPVFDLQHYKSRLTAAQFDAIEVAMRQRAKELCGTLSLRKL
LTWLDNKFYPLMISTGEVVTSEDAGVAETQQDQVEVPDASSAAANTGESLTATTPETTLG
EQQHTDEKTKQKKDTSRKSCRFFLRQSCKNGDNCKFSHAIKNPKTPKPETTAAETVDTAT
NSDAERRKKNASVATNQKHSKEKEDKVSSPSPVESKPKKTKKPRPCKFFARNKCRDGEKC
KFLHEPNTKENADQDTEAEKQHKSRGIVIKVLKASVEATEKEELDDATASATEKRASSEE
WSESQQKALDEALKKYPATIDKKIRWISIASEVNGKSLNECIDRFKYLCQIVRDEQPASA
VTESIKAKETEEEEAHAAMDKRIIVSDGRVSIQTEPEVTGSQIRLEDLFLHQIGTLIPHR
LVCQVQCNNCPLKFDAKLGLDSASIRKWCPRCSVLHLVSLRPVFAHAGSSILAYVDTNEN
CGVVDVVPSELLATCLECGNEVLFPSVTPGRRSEHACFSCHTKLALMIKRYVVGHVSSTA
TSCGKANASSSPQLSPKSKQKQGGAKKVVENFVLGQPLPQKGACEHYKHSFRWFRFQCCG
KAFPCDVCHDSSDCPQANMGKIASRMICGLCSKEQSSAIKECSCGNKVGRKKIVTSYWEG
GMGCRDSNMMSQNDKKKFRGLNKTESTKHKRVGVDAKKHREQQQQNGATNAAH
Download sequence
Identical sequences K3W784
PYU1_T000825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]