SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000903 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000903
Domain Number 1 Region: 60-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.21e-22
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000903
Sequence length 401
Comment protein Name="PYU1_T000903" Note="Similar to V-UBI: Ubiquitin-like protein (Orgyia pseudotsugata multicapsid polyhedrosis virus)" AED:0.380217193601883 QI:0|0|0|0.5|1|1|2|0|401
Sequence
MQQNVTQKAEAKKKSDNQEDAVVITINAESSSTDAKGETPESSGGDQEQQLQQQREDLGP
DAIQVRILDLNGKFFNIPCRLDWQVSLMKQKVLECTEVPIAAQRLIYRGRVLEDESVLAD
YKVEDGHTIHLFVRMSQTPDLETLNADAATSGVSGSHGSRLEDGSQMTIVHISNDIISSA
VFPSDSARRVDPLMLDSPLGNCARRVKLWSSFLLIIYTMKVMGQFALLANDQQARSQQST
AEGQAAADREDQRERMYDYPQYYNQDPVAGVVELIIHAFGVYVGGVGFKAAHDTDIRPIR
FFCRGVLWLAILTIAEQIYITIQINNSDIPNERIQFAYGAQAPSKDDIVSANIFQTIMLV
IMWVIAIRHAYWHQEEVNAYNQSFAAAAMNAVPPVHLPEAV
Download sequence
Identical sequences K3W7G2
PYU1_T000903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]