SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000925 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000925
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0017
Family Centromere-binding 0.035
Further Details:      
 
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0597
Family Centromere-binding 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000925
Sequence length 324
Comment protein Name="PYU1_T000925" Note="Similar to PDC2: Protein PDC2 (Candida albicans)" AED:0.0226244343891403 QI:0|0|0|1|0|0.5|2|0|324
Sequence
MQPPPAAAKPRLRSSNLTHEQKRLICIHAKQNPAITQTQLGQWAKARFALATTPSQSSIS
HTLKRKHNFEHMKSEELASKRMRSVKFPDLDIALANWFLYCQARQIKVQGDEIKAKAHLE
FVNPAAERVDDDVELTDQDFVDTAVNAMLLGNVAGGGVTGDISRRAARARAAKKIETSGS
PYSSSIAQNGAEVPSNDRPQVMVSLRATKSPLDRSLSQQPREDEPQSATATAATSDEEWQ
TWTASQSRSKTSDDAQALQRVIHLATEMSAEPSTVLDLNRMLFEVTQMQSLSGALRQKLS
KDETALQPTGVCRFTFVTPTKHVV
Download sequence
Identical sequences K3W7I4
PYU1_T000925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]