SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000982 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000982
Domain Number 1 Region: 427-523
Classification Level Classification E-value
Superfamily PUG domain-like 1.31e-19
Family PUG domain 0.003
Further Details:      
 
Weak hits

Sequence:  PYU1_T000982
Domain Number - Region: 3-54
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000355
Family Ubiquitin-related 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000982
Sequence length 528
Comment protein Name="PYU1_T000982" Note="Similar to SPCC1442.07c: Ubiquitin and WLM domain-containing protein C1442.07c (Schizosaccharomyces pombe)" AED:0.0562064226011496 QI:0|0|0|1|1|1|4|0|528
Sequence
METLHVLFKGKSYAFPLPSGAATTVAQVQELLAHELQVPPDAQRWFQKKKKIDTNAIDRL
FSGVCEDTQQATLYVMAGASNSQIQHMEKVHQSVDVEQSIRANRRMVSISKLNQIATVRD
AVSIDYRFHAIEVLPNFSDKDRAREILERLANDRGILAVMAKHKWTVGTLAEMYPDGKVG
VDPVCVLGLNQNKGQKILLRLRTDDLLGFRKYLNIKKVLFHELTHNVYSEHDAKFFTLMS
QVEKECAALDWTNAGGASVGGGSGIARIDDDDDDRSARSTGYKLGGGTSTSRLLLSQQQV
ATKEEPFRHVAALPDSGGVSTEPTPAPKDLTETSPASLSPDTPATSESVLPSRGDQQSHE
ETTRPPLSHDMNPTPAAPSAGHGVTKVKSSSPRASAVDDGDVEMTDASSAIVGIPGYEPS
DRELRIVGAVRALCERHGREHVAKAVSLLDKILLNVMQHPSEPKFKAIRKGNKLFGARVA
SFPEALEFLGAVGFEDRDDAYVLTREDAALLWVGRAALEPVLPTTTNN
Download sequence
Identical sequences K3W7P1
PYU1_T000982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]