SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000987 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000987
Domain Number 1 Region: 308-364
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000345
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 524-648
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000025
Family GAF domain 0.045
Further Details:      
 
Weak hits

Sequence:  PYU1_T000987
Domain Number - Region: 68-123,165-264
Classification Level Classification E-value
Superfamily Bet v1-like 0.0714
Family STAR domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000987
Sequence length 685
Comment protein Name="PYU1_T000987" Note="Similar to ZK632.12: Uncharacterized protein ZK632.12 (Caenorhabditis elegans)" AED:0.0263826309744677 QI:0|-1|0|1|-1|1|1|0|685
Sequence
MSTTGVSTDISSRGYGDQIAAHYKVRESLTRDLERRLEDLGERRVRKLIRWVNGDDELEA
SGNSSSLKLLQEKENYRIYERIDEKEKLLVVKGVLLLQNSSCDEVMELLSGKTGSDVQDF
LTDVFAAQYGDSTVLHFTDLGANFQQQSSVSSDKTSRSSSVSSVTLPSATTMLFQWLALK
DMSVQLPLRDFLFMRFNQSFPADDPTSQSKVAYGASIWESFEIPSCRPIFGATQMVRHKL
RNCGYVVESSDETDATRVTFFITAPLDQASNQSDRAWLMRMAGSVRLLPSALVNLRIREN
RLIDKSQWDSRDKCALCTTSFNMLKRAHHCRICGTSVCSKCCSVRRDPRSKSSSGIRVCM
SCLNGEDTSALWGASMTKKHLGNSSITSSGSSRSHHQQSKTNRDSNTSKDSWSSARDLER
STRTSYQSSSMDSSFSSTSRSFDDLSADADASAALSSLRSNLSRTIDEDPVDEDDVLANT
SISYPLTYQKGNAWPDAPIPATEAARLQKIKSLNLSQTYAKFHLKELLDLARSSISCPVA
TVSVITAATSLLVTAVGLQGDQLPRDLALESHVIMSATPCVVLDTQKDEWCAHNPLVSQL
HIRFYIGIPLVTKEGIVVGVLSLGDVATRDKVKGSDLRSLLRIAARIVDKMDSKNYIEPS
SAMPSSSSSAKTTRTSASIGGMLLL
Download sequence
Identical sequences K3W7P6
PYU1_T000987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]