SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000994 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000994
Domain Number 1 Region: 581-641,926-1106
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-30
Family Tandem AAA-ATPase domain 0.0076
Further Details:      
 
Domain Number 2 Region: 342-370,413-448,479-539,574-683
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-28
Family Tandem AAA-ATPase domain 0.015
Further Details:      
 
Domain Number 3 Region: 810-855
Classification Level Classification E-value
Superfamily RING/U-box 0.000000924
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  PYU1_T000994
Domain Number - Region: 298-343
Classification Level Classification E-value
Superfamily F-box domain 0.00183
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000994
Sequence length 1160
Comment protein Name="PYU1_T000994" Note="Similar to At3g54460: F-box protein At3g54460 (Arabidopsis thaliana)" AED:0.167527993109388 QI:0|0|0|0.5|0|0.5|2|0|1160
Sequence
MAPPPPPRVVIDLTAGPMTDESDGERLPATPTSDTHVAVSDDSGAVYCQTIEVLAPLYVE
IKARTAAMRDGDVAVFPVTFQRTEADWIKIVFPHVSLSPTNFQSPPLEKELACVNSTADG
CRNCRFAQLLRGLLVLIEKRVFIVNAKYIVSSPAKRNAGDAPNANSAAANSATQRTKSNP
GPPPIATIQLSVQLNERAPKSIHLQEFDFVISHLQPAILSVVGYTRVKQKNPNAAEDAVK
HAKQSSCHVMGCNLHQNDGKLPGLTSEKLFLNDVFQSLTAPADMNQMEIRDDATYLKRMK
QPQREVIITDLPITALQLLVRMMNARDLAALSGVCSLFQHLSYEVAPGLNLVLYRHQQKA
LKFLLYREAPPSARTAAIPHPFMFPPVRQPNTPISIDLVDGRILQEPTPVAQDSCGGLFC
DEPGLGKTITMLALLLRTKGQRVKAVAAPRAVERDGPLSRLRSSEARGRTVLPHTLIKSA
STLIIVPDPLVEHWKYQIETHVEPGALNVYIDNGKKLPTCQQLATYDVVITSFTRLAQEW
KWNRPVSALEARAPERYGFEDTARFIDGEIRGELSALLRIHWVRVVVDEGHKLGGTTETS
QMRMARVFHAEKRWVMTGTPTPNTLQSADLRHMHGLLVFLQDAPYGNPDGKAWLKAVAKP
FERNEPIAFLRIKHLLSRIMMRHTKRSIRDILPDPIRGVAIIDPTPKEYDVYNAVAASVR
ANLVATNYDPKYPGRLHWDSLLNPMNRKYAKQVVSNLRVATCGGMNMAILLTPAALVEAV
NYAKDKTQIEGDRLTTVLEYINKAQESGMSTPCGRCNRRFKLLMVIPCGHLCCADCTGDC
MESMGPHCPICNVVFDFEIFQELQPGFEFTTEGFGPLDDLTQQGAAARIAQRARDEERRE
NLRAWQEQQRNGEARVPRPFLAINYLRDFDIVDASKALYVVARVKELKQEYANAYAETSN
SRTYAPRHLKAIVFSQFNEHIWSVKIAFAQQGIPTADFIGGVSSVHRMKNLATFRNDPTV
NVLLLTEMGSHGLDLSFVTHMFLMEEIWDKSLEKQVVSRAHRMGARQAVVVEQLVMRDTI
EGLLLRMNDQVLKRQERRLEAEEAEMEMEMALRYEGQLQQQQRHSNKLNGTGNLEGTFRP
HHKSKKRHHQKVCVATQRRE
Download sequence
Identical sequences K3W7Q3
PYU1_T000994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]