SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001004 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001004
Domain Number 1 Region: 1002-1066
Classification Level Classification E-value
Superfamily F-box domain 0.00000314
Family F-box domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001004
Sequence length 1197
Comment protein Name="PYU1_T001004" Note="Protein of unknown function" AED:0.0472979704761698 QI:0|0.75|0.4|1|0.75|0.4|5|0|1197
Sequence
MEFGELLLDRSNPLSWDRERPRFFLEICSWMASVWYSYTIFHSGLLSIGGGALFAMGLAV
FSDFVAAYLRILEARMHRQQQDATPEGVSWLKAVFSYACVGYLITGSGRILHRYLSGEVT
DFQTIEDLVINYFLITLVGVSLIVASELLMLYQPTRTAGLILQARIADGRKNWGEHTLRS
LVEVTVTFGITVLSYKMSDEVVWSLQVGTFSGVALILSEEYVYSRKSLFAAAGAQDEIRA
DHWIKLAPAVVMMMFFCVQVYSAMMMMLSVPSTMSVAFLWFIVISAIALTVIALTDFNIV
VSKFNERAKFLVGKLCILGTTLIACKVCHGLPGILFSWYLSWFSISFSRECWNDIQKAAV
QKAVIAAKARSSPTGRIVSATECEPVPEILFSLSRKLLQYIKFHYPYLYKRTKWTFISMV
VVSCLDVCSTLFILVKQNRFELSLSQFSAGNVVVSAGFGYLTSAVKQELHPEVLLRTGFQ
HAKNKWMFFPLQTFIEATVFVGVLLGTFTATSTVFSSLTLAALSGIVISFGSHWLCTRLQ
LTVGNSVRMRLTATCSVVFFLVLFSYISMMAMFWIYHNIDSLEATFCLASLSGVVFLASS
ELFLLWEPTRKIGQLLQERVTCAKDNWQKEPLRSFLEVFTWFGVVYGSFALYNDLLLALQ
LGTFSGIAVTLSGEYFRRNRAKLIPWRSELLVEEDEDIILEKVDEECNSGTKCSDRPRAL
PVMLLFAYIGSGTFQWIFENMRSLEVTVVLATIAGIVFLCIADLLVMYKPTRWVGIILQD
RVIHVKRNWTNYPVRSFVEFGCFLGVIYGTYAIYCDFFVAVQVGTLSGMLVTLIGEQVRS
HARARPKSDADLEKSQILPLPVMCMLGLVGTVAFNIIYTHRRNIEVAFVLATTSGVIFAL
LGDMLVIWDPTRKIGMIIQERILFFKDNFIDHALRSWTEVLSCVFAWYGSYVCFWPGDLL
IAIQFGTFTGIMVCVCGELAMEYIAEVKHRLIQGVSARLALDTQKECAFLNLPYEVQFEV
AHFLAPEDLLVARATCHKVNGMIKAESARFWLHASLRRKLRDRNLHQERSRAHNSNYRMR
SQARSLIYEAITLILPKIVAARDPAQVLSSGTGISRAIKWVYLNANWIRKQNLSPLDKEE
TDPFSFVAAETLSTVEVFSHWHLVIVAFATMTLIFIGQFSSDVLRAHVFPSSFTWPG
Download sequence
Identical sequences K3W7R3
PYU1_T001004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]