SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001014 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001014
Domain Number - Region: 9-104
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000177
Family Homeodomain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001014
Sequence length 123
Comment protein Name="PYU1_T001014" Note="Protein of unknown function" AED:0.0853658536585367 QI:0|-1|0|1|-1|1|1|0|123
Sequence
MTITKGTEFTEIEKGEIIGLRTTGWTFAAIGKRLGRLPTGISKFWRNQNSYRKKKRPEGQ
KKMCKRTERRIVLEAKKEGTTASAVQATLGVDISAHTVQRVLQKAPFMRYGKRNGAPGSR
KTT
Download sequence
Identical sequences K3W7S3
PYU1_T001014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]