SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001035 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001035
Domain Number 1 Region: 16-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-22
Family La domain 0.001
Further Details:      
 
Domain Number 2 Region: 94-180
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000387
Family Canonical RBD 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001035
Sequence length 578
Comment protein Name="PYU1_T001035" Note="Similar to Larp4: La-related protein 4 (Mus musculus)" AED:0.159792291609854 QI:0|0|0|0.5|1|1|4|0|578
Sequence
MSAAAVEATTQQKQPVGDELKQAIKRQVEFYFSKANLATDAFLVSQMNSQMYVPVDVVAS
FSKVQQLTNSTALLVDAIRDSSVVSLNDAGDAIKPNLKSERNTIILREIPSATPPADVEA
IFAGCGGNVVSVRSDVGDTWFVTMASEEDAVNTLLALRSKKFNDAPIKARLKSENTLKSF
FPTQPAESAVAPGGAYSSRGYYGAAPVGYYDVPNNYGVQYHAVNNARAPYSNGAVDNRYT
TPRGGRGAAAGGAYRQHNQGGRGAAPQQQKDGKAAEQQPRSTPSASSKKSKAEKKAAKQA
AAPASNGTAGKKGAAAPAAERQPILSSSNFPPLPTGEKPSDAPIQHTYHHEDIMEIVKHM
DETDCTLPAGKMDFDAHPAALTAVAHPDLLRNQRTYSIEQAREAMRQGRPIRSDSVGSID
YESMMYGEDYTKEARELRKQNSDGAVAAGADGKSAASTAAPKVFSFASAVIHGTPAPADV
VVAKKKPAAAAATPASAEKAKTPKAAAKDDKKAGKKASKAAESKAAAVDEILPKAGAWGG
RNFLDVVKSEPAAVQPPAAPVKAAAPAPAKDAKPKAAK
Download sequence
Identical sequences K3W7U4
PYU1_T001035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]