SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001041 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001041
Domain Number 1 Region: 82-180
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-29
Family Canonical RBD 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001041
Sequence length 258
Comment protein Name="PYU1_T001041" Note="Similar to TRA2A: Transformer-2 protein homolog (Homo sapiens)" AED:0.00579898835712789 QI:0|1|0.6|1|1|1|5|0|258
Sequence
MSDKGSSSPSNAGQNDDSASHSPKSPRSPRESASTGSPARGDRSPRDQNGEAAAEREDRS
ERRAASSRSPSPARSKEAAADVDPEAANPGNNLYVANLAHRITQTDLEEIFSKFGRLDKC
EVILDPVTRDSRGFAFVTFEDVRDANDAVNELNGKEIQGRRIRVEHAKRKRGHEKTPGKY
LGPRLASTKYGRDGRGGGRDRSRERGDRYRSRSRSRERGGYSRRYDDRDRYDRRYDDRGD
RGRGGYDRDRYDGRRSRR
Download sequence
Identical sequences K3W7V0
PYU1_T001041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]