SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001043 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001043
Domain Number 1 Region: 3239-3304,3496-3529
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000328
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 4516-4625
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000224
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 2480-2636
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000777
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Weak hits

Sequence:  PYU1_T001043
Domain Number - Region: 4332-4372
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000299
Family PDZ domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001043
Sequence length 4677
Comment protein Name="PYU1_T001043" Note="Similar to vps13D: Putative vacuolar protein sorting-associated protein 13D (Dictyostelium discoideum)" AED:0.0280490966121345 QI:0|0.42|0.25|1|0.85|0.75|8|0|4677
Sequence
MLQRAVALLLQRLLGKFVSFDSSMLRLSLWQGDLSFQDLQLRLSYGGGSIGHLSVKIPWR
ALWTQAVVIKAQNIRIFLHQTPKSTALTLQGLVDDDGLVGNTAIDNADSGDIADDRTYLS
RLVAHIISNVQIELSDVQVRYDCTSTSLAKRPGSATLEIGFVSLINTNANWELMFTPQSS
AGMESRKLLTIEGVAAYIEYENRTASANAPQICKKYLFHDWYSTIKASLYYHSSNASFPD
VELDVDIGSRPSHASASCDICTSCAPLEKSDGLAVVQPRIHFGAEHIDVMYAILIEVKAP
YEEYDRLAMLTQQQASRPEGFLMVLAYAKQWLLSDCLDGVAGETYVLAGDEDDDDDDEFE
DAITPPSLYVRAGMHQGVSFVFFSREVDDSAKAERRVWTWVLGEAWASMKQSCVEDELQL
MVESLRMYEKGGTMQQYEIISSVTSPDAEKSPFLFFKGIIPAYQSRLVGHQPVMDLQLRQ
KTVLALKDETLVLWMTLFAPVYLWWKQWNLSHPSKLLAHNEARIAPISNMSIDLESLQVL
LSVRECFCFGAELVQLRGATRVSDDQKLVVSGFQSSRARLFSIDQTLDLIQAAESLAQFK
GLHEILVISGDTSLVKSSHSRTNWSVEAYACVHTGSGQQSQGRGLAALGQERETAMYNYN
IVLPAISIDWTVDELETISWAIGKWAFFMPDSSPEGVNKDLHLRHGKTQSRALCHSMWSI
SAPEIRLRVAEERRGGEYQKGLFTLSMRNFQYENRHCSTTDSQRITMGSISLSEGSNVFL
DIEGNSRLSSPAVNILHQVQRYYSDSASESAQNGDSSVLYFVGQTTETSVLLERVTVKLF
LPSVDIALRWLGSCYDRYNLGFILSTSYGYDLEQFHENMRYLKTNSSMTNTKTPSDYHDE
YVVNVMVPQGCKIHILHLAQSSPGDASSAAPAEVGIVECASLSLQSKMHGNDTELLPEMK
GTVRNLQVRDLTIPDRLPVETSAMPNRQFIGSNQSGTEEGGDSGSFGLKNVVDFVVTSPR
DDVDTLYQDGRQTPGTIVRVRLDSVCLLYLHRVYKQFHHYIADHVLALLANPFDYAPSAD
KACEVFKAYDVDVSGLPVSVEDVLKMYYDIVVGEEVGSGEVSGTTVNLLDSIRYEVVAND
LTLILPRSSFSTDSIVLRCTNARLWSSGIDSANSDFLQSGNFGDDGRLSHSSAVSDAIMA
KAQQSRRTELRNIKRLVKNQRSRVLSNRSQLFIDFKNATQQAQNYLHEGFEALPEAEEAV
RIIQNKIVELDQQLDLLGTYLKEVDEAIEVAKAEGDALNNGGRDSLVFIASAGLRGRTAS
AAQSEAMQQIKDAVLNMSQYLMTPLFTADDAEFHDARTITDTRASPSDADMSASSKGLLE
FELVDLSGTTSNSTLPLFHHALLTGRIDSELESLSEATLSSYFGINLSLNELSVGASPEQ
YLTLLGAIYENFKEVSSVVDEDTYPLCKSCNGHHYDNEYCNAIWMRIPIKVADAALRISN
MEYPIADMFWEQLELVFVLRTDDSLELNASALSFNAIDVRPTRCTTAFDIVRPLVGDGLQ
IVYNQKSDWTDSVYSLNLSNTNCLLIYPAIQEVVEYFLNPIYKENEFFDYDVGFMCPQPP
DWKKMEFHMNSDGCLFSLLEEFTKTDSRALVVVSDIALAFSTCQNCDDIADMKKCHFSLD
QRGVYFSQLPDLQIDVSFPLSNAFQLVVDHFVEGSTVLHRRNSFVLAPVETRFSVQDGYL
FMNIVNNYLQWIPSAGNAARTKAGNENKQIAEKPMLRSNASTGAARQYAIDKLLGDVGEM
RLVLVNNSLGIPIADFQMREIVCEYVQDEDCSTVVGGILSLNYFNNSIYRWEPLVEPFVV
QVRVHRALEENSRVEVFANLPNTVNLNVTPAMAPLLSSEALKQADFVTTGSKSTAPFWIQ
NKTGMDLKFSFRRGKGNIIQQAVPNDLKVSVDCREQGDMRSFDSTAADRFLRDVDRNALT
VNHTLSVWLNGNKWVSANPVVVDVVGHVSIPLREAVNVHARESIDGEIDSEDDIGPPILV
AEITIQPDGSKLINLHSQVVLQNRTSVPLMVWAFSPRDGGSVKEWVIDREQLCHVPLQLI
HPQSKISIRPSPYVQYAPLATSLEELGDEARVVKSINTKRFIRSGNCVCNFETFTTPEEL
KNATNYMVRTGNSLGTAPLSGYVVRDLPTWKCTYDVEAYYLMRATFSAIEEVKPAGGSDE
NLHGIDEEENEKVEDDFLNVFSDENARRRMNHPLSEVNYELDEARNNNQRRGLYEATNSS
LYYLSVSPFATLHNRLATAVAYRLLNGSLQLIAEGILAVGNVLPLFQVDSSSMLYISFRL
ENYNWSSPKVIVNPKSSSYTVPYKDLIEPVELQGRVFDRDVAWEQGNVPNLQLQVKLSGR
DIIVFCSVWIVNHSDLDLEYCSSASSSSKRLDSVLKYVHRRHTSEAEQNAIFSTRTLSFH
DDGDRDRVMTRLQKIKAASNPVALIVVVKEARELYNAQYFGSQSPYVRASLYVLKNPQDR
FLDRPEMHAVCTATTKPSPSGGLNPHWDGRLQNTLLLRFPEDVKSLEMARVIVEVRNVRY
GIDTCLGVTAVKMESITKDRKKAAAFNWYKLLKRKSSKGKQPQTSVHRGDVCMSFSVGSS
QEVQSELDGADELYEEEDDRQSPSMYNEERPSLSSPSGSEFFNVTDEDASMFETQTPGSF
PSSSMFRSMHRMQTPASESTFLPAAMGNGNDTIVGPPGSIRVRQQYPISEMESTRAQQEL
MSYDPTSTRSIGGKLLNGASISPRPMHSGNSRPLQVYLPQNRFAFVVVDIYPNMLMSDIF
ELVCMKCGFHGVLDINDFDFYELALPRFVSLRSAGRPEGDRWYGQRIPMSSKVEKHGRPH
GLHLCHKMTMTTIRLYDESSTASTHHVTPRSLLSSSRKTNPAQNRPMAWGDVLGYGAGGK
NWDVLRVKSQSSPWSEVIRLNRNAMGNSGVAQVISLTNEVYDQDQTSDLRKGNQEIALWS
CYGTGRFSDTIIATIVPRYILINRTGQTIKYRQLNVPHTFRLGTNDLLPFHWPSASKDKL
LEVTLLHGYTWSGSFRINSIGTTYLKLRDSNDLSRIYILQCQIEMVGGSIALVFREESKR
FPPYRIDNMTSFRIQYKQSSWGTDKDFDELQPRSSCPYSWDHLNGSEKGSSSASYQDPTF
SGSSTTYARSLQVRFMRVNMSTSAAGDSEKDAVETREYNLDEMTSHRRIQLQRSLPSQLF
LMPEYKGFLLKKDNLLKWNKKYFRLYESMLYYFANENDQELLGVVDLRTGSDVPGAGSVA
IFEKTAESQGKGGFMSLNGFVSSISARQLGGDDEDEDVDEDDERARDLVQLAVSMTTSTA
LCEQSERFVDRTLSGEDSKAKAGVTRKGFYVNGDTVVAFLVGDSGRMSASQAFSTAQEML
LLGVLKLVQAGSSSTDAKKSLPPSSFHSSKSVWYSVNSINLSDDTDSVDSEEDTPQNALK
TPSKTPKKTKKKAIGTAQFSIITATKCYDLKAKTPKIAKAWVKRLRIAARGSGGTLEEET
TDEVPTTMINSGPKAHRVQKDIVPIVQNAKTYVHVRIRADGPTKVLELFEGGEEDFDEKE
SKQELSSATSAASESPTASEASTNAFEALTNGISIHLRVDSFGISCVNELPMELVYIYFA
GINVHYARVNSKMRLNMTLDDMQVDNQSGEATFNKLLCPRMHGENSASTERKRSISNGDE
EMASMIGERVSVIDGGEHGGGLVANEHMFSCADCKYRQLNVATMHFCCTWSNEQGTTDYF
EHCSFWLYPVISQLDEELLVAARAFLTAMMQSLSQNKTQSRGGEIRAKSIPIETMTESLV
EYKENTMSDDLDPLKSLQSSTASSSTEVRKVYFALLHIHPIEFDITYRSDVFQGAKLNIL
RETRYKSNHSSSSFLRDDFNRTTSVPASMGGLPRYDFDRPDLAEDAQKSGVAWAIPSLTM
HVPDLDNAPLRLNALMIEHAFGTSGDLTRRVSKYYTRQLWKQLHKILGSFDFLGNPVGFL
DHIGTGVRDFVYEPLEGLKVGGKGFSKGLAKGTASLVSNTLDGTFDAASKISGTFGQGLA
TMSLDDHYQQIRARARRRHVRGIREGLVQGSKELSLGVYEGVAGLVLGPMRGAQENGAFG
FVKGTITGIIGLPVKPVAGIFDFASRATQGVRNRSLQNGQNMRRVRRPRVFGRYNELKCY
KEADTIAYDLLKKVGGLKLSGEKIIFYNEIIQSVLASELTKQAREKRQKSDTTKDRTKSF
RRSLNENEVKQINDGLNGRGRKLVYEVTFYQKKLGLDLETDFYCENVTVKAFDENSRHHT
KVHTALRPDQRVLQEGDCLVTVGGVDVRGIGFDETLALLRGTARPIKLQFESCDEQVNEG
NGTQEGSTGENSVLAQASPTSAGVADTDQGARLKVQLTHWLIVTEQRALYINVSSFANPI
VEWMTPLRYIYRVEWMRGSRICLHLSVGVDSLPTGPRLRPSLRALDGHERDMNVFLDVMW
HSFGSATAEEQELWPSDTSLNGFLMKKGGFTTVKRWFVLSRNCLYYFSSRKELRGIIPLG
NVRLEADSSATTLSIRITNAFRNQPLVTLQMDNGQVVERVQSEIVLLAANRQDFEMWQSS
LAHAAGKGLRHSRGTRFFVPTAASRLEVGCRDTPDFVVAPLAEALKKTVEVFNTKLP
Download sequence
Identical sequences K3W7V2
PYU1_T001043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]