SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001082 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001082
Domain Number 1 Region: 92-148
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000242
Family Centromere-binding 0.047
Further Details:      
 
Weak hits

Sequence:  PYU1_T001082
Domain Number - Region: 163-235
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0017
Family Centromere-binding 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001082
Sequence length 681
Comment protein Name="PYU1_T001082" Note="Similar to cbh2: CENP-B homolog protein 2 (Schizosaccharomyces pombe)" AED:0.0549853372434017 QI:0|-1|0|1|-1|1|1|0|681
Sequence
MAQQQNAAMNEAVGAPTTVSAHAAVTGNVMGDFHAKIGNGNDGDDRSEEDEDDEDDDDDD
EGALGGGVSSNMGNRGSSESPSHAGGLPPSGRRMRLTLGQKREVVDLAASKKFTHRELAE
KFHVGRTTITNICRQEDLIRTETDSADATKKKRKTTKCTYDLRVLDECLHKWRMEVKVSN
PDTKLTGTVLQQKAMDIALKILQEPYADLPDKVRQALSKFTASNGWLDGYRTRFGSFSSK
QMHGEQSVIKNVDIQTRLRELHYSLSQVDLQDIWTGSEFAVAYKPNAVNQNPNAPPSAAD
AAAHGRYTVSLFVSAAGEKFDMQVIGVDRSPLLLEGVNTQQTYNIQYGHSKTGWQVAHTT
VGMLKSLNVLAKSRKRTFRVILDSAVPHVKAAMILDSQGDQRTFFVYDHLQIYFLPPNFK
PPRFHPCHLGIIQAFKARFRYEMIETLFTNYRQSIMNQDPQGFHPVRHMHTRNVFHWFYI
ALHSLDKHMIQNCWVHSGLLPTQTIATLNMKAILSPNAAANGNGATVVPPTTNATGLPSP
AWIYRDLQLLMNEVTQLAPDFLHWIGVPDPLNAQAYAELEGNASVTDPGIDEVQIIRSVL
QKHDFLSTKKLDDASHAAGHFESLDDVAEEQCPRAEEVLASIEILKKYLRLSRDAIPNRV
DAVVQVNKIKKAVGSSAIHDV
Download sequence
Identical sequences K3W7Z1
PYU1_T001082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]