SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001123 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001123
Domain Number 1 Region: 64-146,178-280
Classification Level Classification E-value
Superfamily Rhomboid-like 9.94e-22
Family Rhomboid-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001123
Sequence length 287
Comment protein Name="PYU1_T001123" Note="Similar to PARL: Presenilins-associated rhomboid-like protein, mitochondrial (Bos taurus)" AED:0.0765705128205129 QI:0|1|0.33|1|1|1|3|0|287
Sequence
MGAIGGGVAVTSAMRWQQRQCADNHADTHAYRDEDEDSWSGFFWSSFADIKRTLAKELED
DNTKVLAGIIAANTAIFGLWRVSFSNPSMQRFMWRHFACSYTAIAHGKRVHTLLTSAFSH
ITFPHFGINMFMLWEFGRHILAPANNRNDAWYSRAIAQSKVVDYFRNPKSASQRLQLDKF
MVLYLSSAVASSALSIVVSNLRGTPGVFTIGASGAVMGIFTVYCLLFPERELMLYGLVDI
TAAQALQLTTAMNLVGSVFQRNLAIDCVGHIGGQSTGLVLNQTAALV
Download sequence
Identical sequences K3W832
PYU1_T001123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]