SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001135 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001135
Domain Number - Region: 71-177
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 0.00173
Family FabD-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001135
Sequence length 334
Comment protein Name="PYU1_T001135" Note="Similar to spt5: Transcription elongation factor spt5 (Aspergillus oryzae)" AED:0.23202170963365 QI:0|-1|0|1|-1|1|1|0|334
Sequence
MAPSSNYEDVSAAASGSVTGNDAKRPYYGKCQYKTGKCFNERTLKRNGDAHSLCEEHRIK
QNLIQRRSDRKYQTVHAIRRRERSQRRAVLKKQVSMAVAQQLFYEHQQQKSIGMHQLSGH
SLNALASAHAASSTSAHVPPALASHSPHVASLAPPIQIPGKMDLSHQHHHPLYSHNYHHF
ADPSSFLSSGERLVSPILSFAKRASRFSEEAAENERMGADDEDERENDDHGDEDNEDDME
ETRTEAGETVAGSQRRRSGKEQQFASLAADQVKEEHESPTGIDDFAPDSFLSICVSSEDN
DAAYANLVPIMSTMSEKEMWTEDDIEFLQNLLLA
Download sequence
Identical sequences K3W844
PYU1_T001135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]