SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001147 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001147
Domain Number - Region: 358-389
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.019
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001147
Sequence length 801
Comment protein Name="PYU1_T001147" Note="Similar to YLR241W: Uncharacterized membrane protein YLR241W (Saccharomyces cerevisiae)" AED:0.111343720138905 QI:0|-1|0|1|-1|1|1|0|801
Sequence
MSLDNTGVDTFGSEDRMPSLTIRNGIRTYGPIALVGWIGFEIGRRKLARAYYCRDRSGET
TSPTVEQIKTIPPFLWIWSLYMTSDDVIFQYCGLDTLFYLRFLRMLQKIAALGILMSAAL
FPVYYYASDDALDALYRMTLSHLSSDQPWRFWFTVATMYLMTAWTCFLLWREFQVFVKRR
HEFMSRKSTQQYSVILNGLPKHLQTQQTLRNYLNLLFPRQVLHVYVALECSDLEKLVTER
VKVRDKLEHALALSAKTGDRVLTRTRPCGDKVDAIELHQNNLKSLNAAVEMEMRSILRNQ
AAVASQMLEASMSDDPHQYQYTPTMGDRQVPTLQAVDDDSKVVESAYIKGLRSERKGIKN
TGIMRSAGFVTFSSLKAAQSAQQVLQSSDPTKMHIEAAPHVDDVVWENVGVSYNTKSYWL
LISVALTSAIILFWTIPTSFVVSLSKVKALSEKWAWLGRLVKDHPWIGSVLEQLSPLMLS
VMSALAPIIFGILSKREGHASGSQVETSLLNKLVAYQVFLVFLLPIIGGTLIEALTGKSD
DLKDVSKMLKIISEAIPQQSSFFVTYQIVQTFVNLTLEFLRVTPIIKAAIYSVFAPKLTP
RQRQSPWFGLSPLSNPGDFGTTDGISQYYLVLIFLMVFCGVAPIMCYFSFLYLLLSDIVC
RWGVLCVYDPSLNSDGAFFPSLYRFCIGALIFSQVIIATLMGTKEVPLPALFSLFLPFLT
ALFHLFINARYPRTAMNLPLDECVLIDSRRARQYEDLEKILEDMYKQPAMAERAPLEPDY
QGLSSDPNEDNRVSSPPSEVC
Download sequence
Identical sequences K3W856
PYU1_T001147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]