SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001168 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001168
Domain Number - Region: 418-442
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0566
Family Canonical RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001168
Sequence length 888
Comment protein Name="PYU1_T001168" Note="Similar to YLR241W: Uncharacterized membrane protein YLR241W (Saccharomyces cerevisiae)" AED:0.0174353205849269 QI:0|-1|0|1|-1|1|1|0|888
Sequence
MTASIATTLAEENATRSPSEVLLTTAIVYLPLFVLAWLLFEVLRRHKPMLFEPVNPFNFS
AADRARWFAWIPFVYSISDTDIFEKCGLDAWVFLRFIRIGQKVALLCVVSSFALFPIYAW
KPLTLTVPEKVAQAQAVEGAETLAEGFESLAEQVVLHVDWVERITLSNVGPGDWRLLFTV
LSAYAITFYVMRLLIVEYTTYRKRRHAFLSKNAAQQYTIVVSDLPLALRRPQTLMAYMDY
LFPSTVYNVYIGVECRRLEELVEQRTQLQYRLEAAESDLQDAEAKNKIALEEGKAGSNAQ
TLRPHHKVNYRFLGICCGKNVDSINYYRQEIEKLTQEIVKQRKSILDQQFDPIKESKPQY
GTVSNSRKWSSLRNLEQKLASTLRSSTSVLNDETSPLLKSSIQDTTGANDGKSSSDPHVM
RSCAFVSFRSLRSAQAAQQLLQTENPIKMRVQPAPHIDDVLWENFGLPQTSKSTWVLISA
IATLLIVLFWTIPTAFVTSLAKPENLRRMSSFLGHLLDTQPWLQRVLEQSTPLILSLMNS
LSNVVFKMLATREGHLSVTEVDASLFSKLNSFQVFQMFFVSTVTGSILAQVAAVVEQPSR
LVFFLGSSIASQSLLFITFIITQICVNLPMMLLRVTPILIGTLHQILAPTYAKKPVPQPW
MYLNPLNYESELEAPFSLAQQYLIFLLVVVFAPIAPLVGYAGGLYFLASELIYKRFFFFV
NQPKWNTQNSMGAFWPPLFMFALGALLLAQITLIGLLSLKPAGYGVIILSAGLPCCTFLF
YWYSITLFNLSHAAEHLPLDQCCDLDDERKDQQFTFLDGVYQQPAMAKAYSDPSDPAVTP
SDANAHIDSTGGSVVSQPSSSAPAPPLDTTIHHENSLAALNAADDKKA
Download sequence
Identical sequences K3W877
PYU1_T001168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]