SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001196 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001196
Domain Number 1 Region: 4-137,210-315
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-63
Family FabD-like 0.00000482
Further Details:      
 
Domain Number 2 Region: 139-209
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000000994
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001196
Sequence length 328
Comment protein Name="PYU1_T001196" Note="Similar to fabD: Malonyl CoA-acyl carrier protein transacylase (Escherichia coli O6)" AED:0.0382730599838719 QI:0|0|0|1|1|1|3|0|328
Sequence
MAKRLALVFPGQGSQRAGMATELLANWPRAVGDVLDEASEAIRVNLRTLMGDGPQETLTQ
TAFAQPAILAHSVAVLRVLEQETGQPLGCVATPPRFVLGHSLGEYSALVAAQSLDFADAV
KLVHFRGQAMQNAVPQGVGAMAALMPVSASDAEEVCRMAAHETQRVCQVANYNSSKQIVI
SGDADTVDAAIGIAKTQKKVRRAVRLDVSAPFHCALMEPAAKRLDERLQELLPVLRSPTA
PVVWNVEASASTKTPEEIRETLTQQVVQPVKWSQSVDFCLENGVDEFLEIGFGSVLTGLI
KQHAPQANARSCGTAEQIRAYLAEQWQQ
Download sequence
Identical sequences K3W8A5
PYU1_T001196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]