SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001285 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001285
Domain Number - Region: 344-439
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0467
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001285
Sequence length 479
Comment protein Name="PYU1_T001285" Note="Protein of unknown function" AED:0.327213822894168 QI:0|-1|0|1|-1|1|1|0|479
Sequence
MAASRSSVHASFSPATGTFTKLKLHHSKKGLTAMKVVHLLHRTGILVAAIVYFVFCVKAT
KLTIEILRGKDNPVMSPPPSDVSLLRTALGTSATTVRDTPLHRTVVHDDGTPAGGTLYLE
KSGASFKACARMSPLATEIVADGFQRSIYDAIVLGAGYNLTFLAPDSIELIVPIVDCSSI
AVVEEYVSSTRMTYLVRDRRTSADVSILTVDLYNQEYFIKAQKEHGPAGVAIVSLVKDLQ
PTTAVDYHFLVALEYPYEEPEFDVYTFLQVDDEGMWSLQHIPKDPKKELPFVLTTAFRTG
FFLKSETRQSTVSNEVPILAQTPLDAITRADSASKTVQYDSWAWVHLVQLLFGLNLLLNL
LILLTVVFHNLRAGKFWIGDAFVPISSTTTIRGAIVLVTWGVSGFWSFYELAYHDTYEIL
GISTTHAYDDIVRADLMCLYLMICGLMGTVFRERVDPLLTMICFEIGFESRRRISQWFP
Download sequence
Identical sequences K3W8J4
PYU1_T001285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]