SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001293 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001293
Domain Number 1 Region: 1468-1547
Classification Level Classification E-value
Superfamily RING/U-box 2.3e-22
Family U-box 0.00061
Further Details:      
 
Domain Number 2 Region: 619-697
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000447
Family ZZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  PYU1_T001293
Domain Number - Region: 257-316
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000105
Family C1-like domain 0.048
Further Details:      
 
Domain Number - Region: 1014-1085,1217-1257,1345-1372
Classification Level Classification E-value
Superfamily ARM repeat 0.00361
Family Armadillo repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001293
Sequence length 1585
Comment protein Name="PYU1_T001293" Note="Similar to Ube4b: Ubiquitin conjugation factor E4 B (Mus musculus)" AED:0.150241167350165 QI:0|-1|0|1|-1|1|1|0|1585
Sequence
MFACKREDAARARHRRTSNEESISGSVVDVSATFPHSLGIDEKDNEERDRCGSASGNDED
RTFAPYMMKLRGMQQLVAELLDVHALSRAIEYIAFDPLAVNAREWWEDVQRKSIAASQRR
KRLARRGTGGEAGDAMTASFARSAFVRECIGDLVGDAHDVVSIQDVCTEALFKILQCLDR
VNRRKSCSTSFSLALRNQADSVKTIFTNVDDAIAFAAGQLLKDWDAIATEEDSYAGATDF
SVVVINMILQFCKIGSLHAFHPHVLVASSVRRVFGRATNWKCSVCTRYSEVKGPAAAPIV
YRCAACDFNLCRECFTRIPNQSQQSEHPAIYLQEHLHVDRFFSLAFRELCDKGRFNVIAG
KLGLELRRRVKDLPVYKSVEIASGAQLLVEMLASPSFALQIVKYTECDWFPVYMNTWMMG
FLSFLGPFVRGTCISDEARVIDAMSEGQSTSTLAVGSEWQDGYRSLKTNFMAIMHPLLSK
TQHPYVVQATLAWLGCTVLSTNKRRRMNRETNDMLDGFLINISTILVQLSLQVLEEEEKH
PGYIDSTYHQGFLSLRAFGDKDVREVPLRDLAGIRGEQYVMDKMKAEEDRLREHDRQCIQ
NYTACASGDDAVHQYYPIRESHYGVACNQCYKQNFQGIRYKCAFCDDIDICGACFEQFSR
QSASAKGHIDEILTTGLDGLQVHMLDHVFIRVGLPVPLYETRHFEMIRFEKAHFRRENNI
FVDDALDPSLVCADCGCSLRDMEVSFKCSNCFDPRFVCIDCVTREESSKNPFKMHAPGHL
YFAITSSWRYTYSPTTPALHFRSLSHPSALLPREASTKETEFFYLAIKSLHFGPLLTLSR
LISTLKEIQELQAFCFCEEEKVKHEARQRAAAERSNARHISSRRPVKMSSHYTASKTRLG
DLSDMRGMIELHLLEVSNVAEWLVFYARTCRWLLKLASPTQDANEEVLTDFSDAFIQFPE
HFFSDLCDIIVLLGLDRLEYHDVMSEIAKTVKVENDDEDGVGSAVVEPLLVMLAQFVTSR
ELTRNPHLRVQALKALMALLSFFSKSKQNHSVAAIFEQNGFLQGFLVRGMLQFHEDMEKY
HLRNNGLVFNSNVSSGDHLLWGFLPTRISVTLLLRYLWQIPSQRKVITNLFQLGSVPSDP
SGEAAPNQLSVLVSGLWSDVAKLLDEGNSKIDTLVQLREIQESAMDGGNMVSLPFRPAMV
DGYIALHSKQLRLTFRMMIEALELLSWMGDTVSLKKIMLKPELSEQCARIVSFLMSSLGT
ANESKSWNFSIQLTRDGKLLLANLVVLVVRCAGLSEKCSPSSFWKLIQESGGAMTNCLGD
LDTHARWALNAITTRLESARYLCEIVDEDESADEMNDNNVVDNEEEDMDEDEALALLEKQ
AADAVVATRSASSIASSRSSQALSIARHLGKRFVSSLAKDGRFDFTRFIKSLDMLRRENC
VDEYELVDSSWVHMFVDAMNKCRDMIQLHASMDELMGDIPEEYLDPLLSTIMTDPVRLPS
GQVVDRSVIERHLLSSQQVDPFTREPLTVEMLVPCDALRREIRLYLKSKMKHFKNEKEDV
LATWGLAWNYMFDGGDWEESTTAQE
Download sequence
Identical sequences K3W8K2
PYU1_T001293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]