SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001315 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001315
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000000458
Family Leucine zipper domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001315
Sequence length 690
Comment protein Name="PYU1_T001315" Note="Similar to HY5: Transcription factor HY5 (Solanum lycopersicum)" AED:0.0410115434148925 QI:0|-1|0|1|-1|1|1|0|690
Sequence
MTDFLRSILQNASPAATPTPAASFPAVKSEMRPVDQIQVPPAACVVGADAAAAALMEKQR
MIKVEMPDPAITPSGAAAVDAGKAQRAARRDVVNARRETKRKTMSTSSPSPEATSAVSSP
SSLSVEDATVDVPIATATVTTEKSKKMKTGKTTSVNVVSTAEPVILDAKPAKKAAASALS
MSASMLFNSEIDALGEERLRAMEAQLESLDPDSKEAKKKRRLIRNRMSAQLHRERKKAYV
GQLEDQLMEKERELQLLQEKLNAMESASQLLKQKMDQVDAAAAPATPKAKEDEVVIKTEP
IVDVSSAFEAPTTAAASAPATVVSRDNWDDYCFQNLEDTEMADVAADDLLRDFDHPFSSA
YAAIEQQNEHEHPQQHHEIHAAKKNLVMMMGVMFSATFFGNSPFFFDVQNGSNFSSMFNA
NPPKEFSQLNIASKIMSSLEKSSWKDFRDIASWTASSDDVADVAETEVEPAAAKAAASPS
AASDITDSSGTCDSPAQIDDCLSLGFETDLIDEFVYPVDDPFAPALADTNWFGDDADDFG
QSDVDDNDDDSKDDELFLPEVTLAAKNETTSKKEEQLASQSMTSRLFDKLTTLWHEKNQV
LLTVLDGKNEVTRRSVADMSSIRKSMENGSIFSKPPSSSGAKTSPLANDQSVSFLYPLSA
FSLAEKEERASSTSDVMFLEVSCQMNALSM
Download sequence
Identical sequences K3W8M4
PYU1_T001315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]