SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001344 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001344
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Fic-like 1.06e-19
Family Fic-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001344
Sequence length 166
Comment protein Name="PYU1_T001344" Note="Similar to Ficd: FIC domain-containing protein (Rattus norvegicus)" AED:0.231536926147705 QI:0|-1|0|1|-1|1|1|0|166
Sequence
MQDSSCLISYDQLLSIHKCLIPESSGQAGIIRSSAAVGYASPRIYRVFIPVGEIEEALQN
LVKTINDSERWKQRPLLCAYYAFAVLVFYIHPFHDGNGRCGRLLGNLIAKKFVGYPSVFR
AADKTIQVPEFLQKAVVTMETVQNSRRQTRQSRLLSTRKENSSMWF
Download sequence
Identical sequences K3W8Q3
PYU1_T001344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]