SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001348 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001348
Domain Number - Region: 101-138
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0431
Family Leucine zipper domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001348
Sequence length 481
Comment protein Name="PYU1_T001348" Note="Similar to GLE1: Nucleoporin GLE1 (Bos taurus)" AED:0.552260296720436 QI:0|0|0|0.5|1|1|2|0|481
Sequence
MSFLVEDDQQATLEVALAFIEACDNVPDSLKSVASPQQSSPSASTTSNDDGLDHLDLSTP
ELLFDQPATLFPEPIRTTVSETNASATTNGQASSLESGSSKARRNADAVRRLRARKKAEG
AYLRDQVIELEAKLRQLQFARLAKNPLHALLQLEDEESELNAEEKEKEGHLTHKLKTVSV
WREIASIQAKERRKSEVLNVKLREAIKKQMKTRALLESLLRKKSNLQGLELLWKDQQEHL
YNDSLLTKEKMFFEELREDIGEMYRMTAKLFERSPDFDVGNMTCTTQVKQDPMFGSFIEV
RTSAPLRGGITDAGELVWQQTLCNTTVLSSVKYYTQKRNVTNSSFQKSYILTIDGPTGPV
ELHGISYVQRVDEPHRFVYMWTSRILLASGKASVFHERGWMLASKVDGHAKYPAMFQTCY
RVAGSDPHQVLYPLGSVTEELKEAVLDALTMRTREYHQSVQNMLIDELARFTIRRPLAVT
A
Download sequence
Identical sequences K3W8Q7
PYU1_T001348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]