SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001349 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001349
Domain Number - Region: 92-129
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0113
Family Leucine zipper domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001349
Sequence length 469
Comment protein Name="PYU1_T001349" Note="Similar to Golga4: Golgin subfamily A member 4 (Mus musculus)" AED:0.351418439716312 QI:0|0|0|1|1|1|2|0|469
Sequence
MSFLEEDDQLVTLEMAFAFLDDIDVDSDGDTSSSNITHSSPGGSMASNDGPNFVALASNL
FLDQDSVFTEQASTRASSRARDEAARKTGSTRAQRNRDAVKRLHARKKAEAAHLQEQVIE
LEARLRQLQIARMSGSSARASSEGVEGEMSAAEKAKYLAIKPRAVSMWLEIATSQAKERY
KSEKLNARLRAVIQKQMRTSALLERILRRKSNLQGLDLLRKDEQLNVYNDSCIKKEKIFF
EELRKDIAVMYHMATPMFERTWGPDIDYISCSTHVKEDPMFGSFVEVQTSAPLRGSVTKA
GNLIWRQTLCMTSVMSPAKFYLQQRDVSESSYQKSFVLIIDGPVGPVELHGISMAHKFDE
PHRFVFAWTSRILLADRHAWAFQEHGWMVVSKVEGHAKYPAAFQTCYRISSSDLHRGSSH
GVHTEELKEAVLDALTSRAREYHQNVQNMLVDELSRAPMQLPLLAMAAS
Download sequence
Identical sequences K3W8Q8
PYU1_T001349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]