SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001350 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001350
Domain Number - Region: 144-185
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0113
Family Leucine zipper domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001350
Sequence length 527
Comment protein Name="PYU1_T001350" Note="Similar to SRP40: Suppressor protein SRP40 (Saccharomyces cerevisiae)" AED:0.587190291977526 QI:0|0|0|0.5|1|1|2|0|527
Sequence
MSFLVEDDQQSTLEVALAFIDECDVDEDSGASTTNSSFAADSPLADTTSHGGSPASDVGE
DSDASFAAGSPLADTTSHGGSPASDATPDPQQLRFDVFVDSIGQTPELSFDAPAKANNPT
KGEEVKMKASDDKASGAKPTRPPRKSSKARSNAEAVSRLRARKKAEAAYLRDQVIELEAK
LKQLQLARLSSNPLHALLQIEGDESKMSAEEKEKYLTIKPKSVSVWLEIAAIQAKERYKS
EALNVKLKDAIEKQVRTNKVLEDILGKKVNLQGIELLLDDQQQYLYNDSLLTTEKILLEE
LRESIGTMYQMVTTIFEHSWDIGLDSVSCLTQVKEDPMSGPYVEVRTNTPLKGGHQEAGQ
FIWNHSVKASLVMHSNKFYMKKRNVTNSTYEKSYTIIVDGLRGPVELHGISFVQKVDEPH
RFIYMWSSRIFLSRGKMAFIESGWMVAARLHGNAKYPAVFQTCYRVWSDPHRGESQSMYD
PNVEVIKEKVLQALTSRTREYHQNIQNMLMNEFAGFRIQQRLGMAAV
Download sequence
Identical sequences K3W8Q9
PYU1_T001350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]