SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001351 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001351
Domain Number - Region: 110-148
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00788
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001351
Sequence length 237
Comment protein Name="PYU1_T001351" Note="Similar to CROCC: Rootletin (Homo sapiens)" AED:0.0221774193548387 QI:0|-1|0|1|-1|1|1|0|237
Sequence
MSFLVEDDTLEVALAFIDACDADADTDTADTSIVLSPSVSFASFDDGDDVACVARRDDAK
PNSLQVVIRSTRDNKLTAQQQLQISECSELSQQQAQTSPLTALARNTSGRAKRNASAVNR
LRARKKAEALSLRNEVAELQEKLLELQHAKRAGKSMQAIMRLQREQAGKEKDAGDANSSG
SSLPPKAVSIWLSIAAMQAQERFKSEALNVKLKSAVERQLHIHKALRELISKPEILE
Download sequence
Identical sequences K3W8R0
PYU1_T001351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]