SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001365 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001365
Domain Number - Region: 102-152
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00522
Family Leucine zipper domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001365
Sequence length 316
Comment protein Name="PYU1_T001365" Note="Protein of unknown function" AED:0.177501845761461 QI:0|0|0|0.25|1|1|4|0|316
Sequence
MSFLLAEGENVATLEEAFAFIESCSDDSSSGGCASASDSFDALSDHSSVWSVADVTSSLS
RSDDSDSSSPLTRDFSRSLGIAIAPRPRIDVQGKKPAPQTRLRISREANTRAVHQYRMRT
KNQILELREEALQLSARVEQLKKRQEYVKKTMIDRHMNTYHAMREQGEPSTALQNSLELA
VAEYQKRQESETLNRKLKHALEKQSKMNKILETFFQRHVAKHVEKKQLLVVSSNDAPIFK
ELLSYVGGVMQSMVPSATASINTNDTSLMKQDPMLGQVFEVTTNTPLPCTRHQLETALLA
HILGFDERNSTSKEGM
Download sequence
Identical sequences K3W8S4
PYU1_T001365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]