SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001366 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001366
Domain Number - Region: 102-146
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0426
Family Leucine zipper domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001366
Sequence length 369
Comment protein Name="PYU1_T001366" Note="Similar to Chaf1a: Chromatin assembly factor 1 subunit A (Mus musculus)" AED:0.36217164532954 QI:0|0.5|0|0.8|1|1|5|0|369
Sequence
MSVFELDDAQAATVEEALAFLDACDPQELALLDSDVSVSSDAQSWLAPFQELMAPLGFDT
LILDHEDANTPKSNESSGETQASDDQHTDNASSLPARQVKHYKKTREANVKAVTKYRQRK
RSEIAELRLLVKKLTAQLARLQQQNEDMVKKEKQEFKQEEVLEAAKLRKAKLLNRKLREA
LASQSDLNKTLQSQIQRQISDHYQELKLVLENHNVVPARAEEETPKLEEKPAAIMPECKE
QTPPVVYGQTTHAQEGADLLYPTPMPKSKDTSMFTKNTFHRTTGGEILSYTARQITVSIP
TDLVKKEPKLDNTLASAAAAWSFGHLGKFLWSRTLSSAIINVDHLIPKPQIDEPKDLKAE
LTANLAAFP
Download sequence
Identical sequences K3W8S5
PYU1_T001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]