SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001488 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001488
Domain Number 1 Region: 120-182
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000000000000017
Family PUG domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000191
Family Ubiquitin-related 0.0026
Further Details:      
 
Weak hits

Sequence:  PYU1_T001488
Domain Number - Region: 245-289
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.017
Family Rabenosyn-5 Rab-binding domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001488
Sequence length 417
Comment protein Name="PYU1_T001488" Note="Similar to Rad23b: UV excision repair protein RAD23 homolog B (Rattus norvegicus)" AED:0.273763731968066 QI:0|1|0.5|1|1|1|2|38|417
Sequence
MTTAQLTIKLVSSGSETLALSMDNFADATVLALKQLIEAKDAARFPVAAQRLIFQGQILQ
NEKKLSEYNVVDGCAIHLTLMPGAARAATHAPTTVAAAPAAISIEPQLRAFLQQMRADSG
YVTAIQTMQKICENVINHPHEEKYRKLRLANAALKTRLLDRIRGTDCVKLLGFQEGVEQG
HLVLVPTAEKWDCLVTGKRVIDQALASSGSAGFNAAPSFGAPGFGAGAAAGNANWAAQAQ
SMLQNPMMAQMLQSDPMMQQMAQMNPMIAQALQNPSMLSQQLQMLQQNPAMMQQINQMMQ
DPNAMARMQQMLGGVSGAGGAGFGGGFGGDFGGGFGSSPFGAGAPSSGASNPFAPSAAPS
NPFAAAPTAAPAVTPTAPVAPAPPAAAAPAPSSAAADETTFDENEIADAIARSLQDH
Download sequence
Identical sequences K3W947
PYU1_T001488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]