SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001567 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001567
Domain Number 1 Region: 299-378
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000288
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.064
Further Details:      
 
Weak hits

Sequence:  PYU1_T001567
Domain Number - Region: 50-131,161-225
Classification Level Classification E-value
Superfamily Bet v1-like 0.0879
Family STAR domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001567
Sequence length 392
Comment protein Name="PYU1_T001567" Note="Protein of unknown function" AED:0.0165394402035624 QI:0|-1|0|1|-1|1|1|0|392
Sequence
MGKRPRYMSPFPALELSHEDSQQLQNIAQLFVQDTIAQYEQYLHAERRTVENDRWKHELQ
KENVRVYSERRPKKRTSQERSYLPAHSMGNDIPTLLVVGTIDGLLHDAMYGAVNPTVDSL
RVKTSYVDDNVVNAAVLATIVTPTPADPFRSMSIKWIEIGQPLHIRMVVKNRDMVYLEST
GMTQLANGERVGYQLLHSVHFPHTHPLEATTRGNMSVCALYRQDDPTAVDLYVKAYLSPS
EGVMRAAIVKSGAEALVSPWRYVHCGRMKKLAWAVQQGHDNSTNSSYSDLSDGPLSARGS
FEMTCTTCNKESSWSPLASSKIRQCSLCTQYTCSSCKVNKQLSWLFGDGGLQQQDLLFCK
SCVQSVMTKSDAMEIARDELISAHETRSTLRF
Download sequence
Identical sequences K3W9C6
PYU1_T001567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]