SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001578 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001578
Domain Number 1 Region: 207-385
Classification Level Classification E-value
Superfamily Macro domain-like 3.34e-27
Family Macro domain 0.00054
Further Details:      
 
Weak hits

Sequence:  PYU1_T001578
Domain Number - Region: 65-121
Classification Level Classification E-value
Superfamily F-box domain 0.0049
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001578
Sequence length 398
Comment protein Name="PYU1_T001578" Note="Similar to ymdB: UPF0189 protein ymdB (Salmonella typhi)" AED:0.24937343358396 QI:0|-1|0|1|-1|1|1|0|398
Sequence
MSTTRARTAENESDAGAAASKRQRSAEATPAAKESAALASAAATSAAEDDHRAAVQLFAV
ELLTQKVVKFLDARSVVCFAAFLRSRNAWRSILSDEKLWDELLQTHFGGHVPVPAPLQHE
QQDEDDASDEDDAFDEGEGDYDDDEGDEDSIQHANANHNASATATVAPAGEQAAASTDVT
DTKGPAILTLETPSFACENFMHFVRSCRERRRFNEAVSIIQGDIGTISSIRGRPIDAIAF
ATGGSLHNPYVGAAEVVFRRAGPELDYHISGRHPVYINAGQVHVTPGFGAGVDKLIHCCG
PVYRGHRCFSLLARTYESVMLAAEREKLHCIAMTSISTGNMGFPAQEAAKAGLRALQNFI
RARSWDGTLAVVCFDTNVYNAFVDQKKRILNAFNVVES
Download sequence
Identical sequences K3W9D7
PYU1_T001578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]