SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001671 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001671
Domain Number - Region: 70-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000156
Family Synaptotagmin-like (S variant) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001671
Sequence length 325
Comment protein Name="PYU1_T001671" Note="Protein of unknown function" AED:0.0871593232942927 QI:0|0|0|0.6|0.75|0.8|5|0|325
Sequence
MSAVENVEARIARLQQTLDAKCAELHVLQTRQRYNATLGIDEDLATGQSVATLEVKVVGG
RNMLYNSGFLSVMQEERLGHDLLVGSLQIPLLHLQDQRLLEKWHVLSKENQASASELLLC
CRFNRSKISAIELDVELLQNQLRELHTFLERQRQFTNQTFSSSERFVPVNHLKGKEVSVQ
ATVQRAHSTRFDAVATFPFQAARKREFVDTPMTSSEPLASDLHRAKRQRTSASDPGPAPT
SVTFTEKLANWLLPSSSASSSPSVAPRPFGAVPVSQGQVSYPFKQQPVEKKRTKKSVRPK
LQKTPSMLQSFEQWLFTEPENSIPN
Download sequence
Identical sequences K3W9N0
PYU1_T001671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]